InstaBasic Online Instagram Viewer

Skirtmuslimah,kalaudahpakaiconfirmauratterjaga😊
.
Apayangbestnyaskirtbungajamalnimehkekdanaksharesikit
.
🌸DiperbuatdrpdmaterialMattePolyesteryangtakmudahrenyuk,lembutsuperflowyNakgosokpunkinilebihmudah((kadang-kadangtakperlugosok))
🌸FullliningmaterialICEJerseyyangmembuatkanskirtlebihsejuksesuaidgniklimpanasdiAsia
🌸Cuttingflare(kembang)yangtakkedekutkainakanmemberikanandakebebasankeselesaanmaksimautkjalankanrutinharianyangsibuk
🌸Datangdalammotifwarna-warnayangcomelmembuatkanandalebihyakinmelangkahdgnceria😍✨
🌸Skirtdijamin100takjarangsesuaiutkmemenuhicitarasamuslimahsejati.Kalausayangayahsuami,wajibada💖
.
.
Ukuranpinggang24-34inch(sesuaiuntukwanitaS-XL)
Ukuranlabuh40inch(sesuaiuntuktinggi155-173cm)
ITEMASTERSKIRT
WARNABLUE
HARGARM55(FREEPOSTAGE)
.
📲wtsp013-6322816
.
skirtbungajamalbungajamaljohorskirtskirtlabuhmaxiskirtflareskirtskirtmuslimahsharepetitesntallshawlkeknischiffonshawlsayajualmurahsayajualskirtbazaarpaknilf4fchiffonshawlfashionskirtfloralskirtpetitesntall

skirtbungajamal.johor

Jan 12, 2017 - 42:12

Skirt muslimah, kalau dah pakai confirm aurat terjaga 😊 . Apa yang best nya skirt bunga jamal ni? meh kekda nak share sikit : . 🌸 Diperbuat drpd material Matte Polyester yang tak mudah renyuk, lembut & super flowy! Nak gosok pun kini lebih mudah ((kadang-kadang tak perlu gosok)) 🌸 Full lining material ICE Jersey yang membuatkan skirt lebih sejuk & sesuai dgn iklim panas di Asia 🌸 Cutting flare (kembang) yang tak kedekut kain akan memberikan anda kebebasan & keselesaan maksima utk jalankan rutin harian yang sibuk 🌸 Datang dalam motif & warna-warna yang comel membuatkan anda lebih yakin melangkah dgn ceria 😍 ✨ 🌸 Skirt dijamin 100% tak jarang sesuai utk memenuhi citarasa muslimah sejati. Kalau sayang ayah/suami, wajib ada! 💖 . . Ukuran pinggang: 24-34 inch (sesuai untuk wanita S-XL) Ukuran labuh: 40 inch (sesuai untuk tinggi 155-173cm) ITEM : ASTER SKIRT WARNA : BLUE HARGA : RM55 (FREE POSTAGE) . 📲 wtsp 013-6322816 . #skirtbungajamal #bungajamaljohor #skirt #skirtlabuh #maxiskirt #flareskirt #skirtmuslimah #share #petitesntall #shawlkeknis #chiffonshawl #sayajualmurah #sayajualskirt #bazaarpaknil #f4f #chiffonshawl #fashionskirt #floralskirt #petitesntall

0 Comments